(data stored in SCRATCH zone)

EMBL: CP000509.PE210

CP000509.PE210       Location/Qualifiers
FT   CDS             complement(231042..231788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0215"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMc02358 putative high-affinity branched-chain
FT                   amino acid transport ATP-binding ABC transporter protein;
FT                   TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79760"
FT                   /db_xref="GOA:A1SD75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD75"
FT                   /protein_id="ABL79760.1"
FT                   /translation="MTDHQAGDVRTIAEPPLLRVRDLAAAYGPKQVLYGVDLEVRAGEI
FT                   VALMGHNGAGKTTTIRTVLGALRARSGEVSVAGEDLTGQPVRRLVRAGVALVPSERFVF
FT                   PDLSIRDNLLLGAANAPRDADSAARLREVEEAFPLLSERSSQLAGQLSGGQQRMVSLGI
FT                   ALMAQPRLLLLDEPSLGLAPSIVEAIFGRLRALATSSGLGILLLEQNVKQALQIADRAY
FT                   VMRSGRVILEEPAAQMRRRPDFWDLF"
     MTDHQAGDVR TIAEPPLLRV RDLAAAYGPK QVLYGVDLEV RAGEIVALMG HNGAGKTTTI        60
     RTVLGALRAR SGEVSVAGED LTGQPVRRLV RAGVALVPSE RFVFPDLSIR DNLLLGAANA       120
     PRDADSAARL REVEEAFPLL SERSSQLAGQ LSGGQQRMVS LGIALMAQPR LLLLDEPSLG       180
     LAPSIVEAIF GRLRALATSS GLGILLLEQN VKQALQIADR AYVMRSGRVI LEEPAAQMRR       240
     RPDFWDLF                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page