(data stored in ACNUC1104 zone)

EMBL: CP000509.PE213

CP000509.PE213       Location/Qualifiers
FT   CDS             complement(234534..235880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0218"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: nfa:nfa52540 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79763"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD78"
FT                   /protein_id="ABL79763.1"
FT                   /translation="MSVLPSTRRGPRARSTSRSVRRSVALGAALALALSLSACGEDKPE
FT                   VSAAETQAQAADLVDLLAIPEGTDLGGDLTWKMGAALTLSGPSAANGESMKNAIDLAVE
FT                   QVKAAGGPTIEVLTKDIKGPDPVAAKQAAEELAAAGVPAKITSMGDGLGAMLENTAKDQ
FT                   ILSLDGVGGAQVFTQGVDYFFGTREVAPSDAVPGALEWLKQSDPEATTVGLVGVDLGPF
FT                   NDPIKADITAKIDASGLQFNGLWETVAPTSQDYASVISKIKENQPDMLLVAFGGGAPGA
FT                   FAAQAKAAGLDSLLMGIEFTEEAVKASKGVLDSDGFHFAMDYFDAENPANPLAELFVDS
FT                   YEKAYGVKPDFYAANAYEEVLMFWDLVRRVVADGGDPNDSAALKAALEADPTFASVYGA
FT                   GEGDGPGTLAIDLKTHGVASRPMGVYEYQDGAVSTLATFDVNAAGFALN"
     MSVLPSTRRG PRARSTSRSV RRSVALGAAL ALALSLSACG EDKPEVSAAE TQAQAADLVD        60
     LLAIPEGTDL GGDLTWKMGA ALTLSGPSAA NGESMKNAID LAVEQVKAAG GPTIEVLTKD       120
     IKGPDPVAAK QAAEELAAAG VPAKITSMGD GLGAMLENTA KDQILSLDGV GGAQVFTQGV       180
     DYFFGTREVA PSDAVPGALE WLKQSDPEAT TVGLVGVDLG PFNDPIKADI TAKIDASGLQ       240
     FNGLWETVAP TSQDYASVIS KIKENQPDML LVAFGGGAPG AFAAQAKAAG LDSLLMGIEF       300
     TEEAVKASKG VLDSDGFHFA MDYFDAENPA NPLAELFVDS YEKAYGVKPD FYAANAYEEV       360
     LMFWDLVRRV VADGGDPNDS AALKAALEAD PTFASVYGAG EGDGPGTLAI DLKTHGVASR       420
     PMGVYEYQDG AVSTLATFDV NAAGFALN                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page