(data stored in ACNUC1104 zone)

EMBL: CP000509.PE214

CP000509.PE214       Location/Qualifiers
FT   CDS             236113..236748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0219"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP1732c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79764"
FT                   /db_xref="GOA:A1SD79"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD79"
FT                   /protein_id="ABL79764.1"
FT                   /translation="MPRKTTRRHRQGDESRHRILATTLEIAAERGYEGTTVGLVTERTG
FT                   LPASSVYWHFKNKDELLAETLEYSYRQWREATPTWEGVDDEGVPDLRAEVRRRLRAASR
FT                   ALLESPEFWRLGLMLALERRAKEPAARGRYVEVRLETAAAIARWWASVLPAELRERDDE
FT                   LPDRLARVHLALMDGFFVGRRADPRWDVGAMVELMAEGMAAYVEGVAR"
     MPRKTTRRHR QGDESRHRIL ATTLEIAAER GYEGTTVGLV TERTGLPASS VYWHFKNKDE        60
     LLAETLEYSY RQWREATPTW EGVDDEGVPD LRAEVRRRLR AASRALLESP EFWRLGLMLA       120
     LERRAKEPAA RGRYVEVRLE TAAAIARWWA SVLPAELRER DDELPDRLAR VHLALMDGFF       180
     VGRRADPRWD VGAMVELMAE GMAAYVEGVA R                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page