(data stored in ACNUC1104 zone)

EMBL: CP000509.PE218

CP000509.PE218       Location/Qualifiers
FT   CDS             239725..240201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0223"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rha:RHA1_ro05231 possible carbon monoxide
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79768"
FT                   /db_xref="GOA:A1SD83"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD83"
FT                   /protein_id="ABL79768.1"
FT                   /translation="MEVTLTVNGEVVTRDVEARLLLVHFLRDDLGLTGTHWGCDTSNCG
FT                   SCVVLYDDEPVKSCTVLTAMAAGHDVRTVEDLEQDGELDPVQQGFMECHGLQCGFCTSG
FT                   MLMSARALLDRDPDPSEEDIREAISGQICRCTGYASIVRSVRWAADHPEGRIEA"
     MEVTLTVNGE VVTRDVEARL LLVHFLRDDL GLTGTHWGCD TSNCGSCVVL YDDEPVKSCT        60
     VLTAMAAGHD VRTVEDLEQD GELDPVQQGF MECHGLQCGF CTSGMLMSAR ALLDRDPDPS       120
     EEDIREAISG QICRCTGYAS IVRSVRWAAD HPEGRIEA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page