(data stored in ACNUC1104 zone)

EMBL: CP000509.PE22

CP000509.PE22        Location/Qualifiers
FT   CDS             complement(23664..25457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0022"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: tfu:Tfu_3066 tyrosine protein
FT                   kinase:serine/threonine protein kinase:PASTA"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79572"
FT                   /db_xref="GOA:A1SCN7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN7"
FT                   /protein_id="ABL79572.1"
FT                   /translation="MSNHQPTVGGRYQLGELLGRGGMAEVRKGTDTRLGRVVAVKRLRT
FT                   DLASDATFQARFRREAQSAASLNHPSIVAVYDTGEEPAADGSGISQPYIVMEFVAGRTL
FT                   RDILREGRKILPERALEITSGVLSALDYSHRAGIIHRDIKPGNVMLTPSGDVKVMDFGI
FT                   ARAISDASSTMTQTAAVVGTAQYLSPEQARGETVDSRSDVYSAGCLLYELLTGRPPFVG
FT                   DSPVAVAYQHVREPAVPPSDHDTELPPEIDAIVMKALAKRVEDRYQSAAAMRSDIERYL
FT                   AGRPVQAPIPAPVPPPPSATDRTAVVGAVPAADDEPPRSRTGLLVLIGALLVALLLAGA
FT                   YFVWPRLFEQAPEQVAVPNVVGKNETQARRLIGEAELAVGTIDRENSDTVKAGNVIRQS
FT                   PEPDRYVDPDTAVDFVISLGVPEVNVPPVVGLDKDAARAQLEAADFVVRTEEKESDEPA
FT                   GEVIETNPPANASVEQGSTVVVFYSDGPEEVPDVRGLMQPQAKNKIRAAGFEPRVIADP
FT                   DSTEPAGTVTDQSPEPGETPSQGSTVTILVSTYEEPTESPTPSESPTDNPTEPPPPVLD
FT                   RSAVSPRSVSSRRWGRAAPRS"
     MSNHQPTVGG RYQLGELLGR GGMAEVRKGT DTRLGRVVAV KRLRTDLASD ATFQARFRRE        60
     AQSAASLNHP SIVAVYDTGE EPAADGSGIS QPYIVMEFVA GRTLRDILRE GRKILPERAL       120
     EITSGVLSAL DYSHRAGIIH RDIKPGNVML TPSGDVKVMD FGIARAISDA SSTMTQTAAV       180
     VGTAQYLSPE QARGETVDSR SDVYSAGCLL YELLTGRPPF VGDSPVAVAY QHVREPAVPP       240
     SDHDTELPPE IDAIVMKALA KRVEDRYQSA AAMRSDIERY LAGRPVQAPI PAPVPPPPSA       300
     TDRTAVVGAV PAADDEPPRS RTGLLVLIGA LLVALLLAGA YFVWPRLFEQ APEQVAVPNV       360
     VGKNETQARR LIGEAELAVG TIDRENSDTV KAGNVIRQSP EPDRYVDPDT AVDFVISLGV       420
     PEVNVPPVVG LDKDAARAQL EAADFVVRTE EKESDEPAGE VIETNPPANA SVEQGSTVVV       480
     FYSDGPEEVP DVRGLMQPQA KNKIRAAGFE PRVIADPDST EPAGTVTDQS PEPGETPSQG       540
     STVTILVSTY EEPTESPTPS ESPTDNPTEP PPPVLDRSAV SPRSVSSRRW GRAAPRS          597
//

If you have problems or comments...

PBIL Back to PBIL home page