(data stored in ACNUC1104 zone)

EMBL: CP000509.PE221

CP000509.PE221       Location/Qualifiers
FT   CDS             243144..244100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0226"
FT                   /product="LysR, substrate-binding protein"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mbo:Mb0384 probable
FT                   transcriptional regulatory protein (probably LysR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79771"
FT                   /db_xref="GOA:A1SD86"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD86"
FT                   /protein_id="ABL79771.1"
FT                   /translation="MTPTQLRAFATVVRLGSVKAAAAELEVSEAAVSLHVGQLRKELGD
FT                   QLFNRTASGLAFTPGGLRLASRAVELLGLQDRTVLEVREAGVGRRMLRLGTTSLFAEYA
FT                   APGLIGLFADRARDLDVELSVHRARDFEQLLLTRTVDAVVGPRPATGDPALISKLFLNY
FT                   QVLAVVGPEHPVTRGQPGIAMLRDQTWLLGPSAADDAGVIPGLLQRIGVPEERQQIFQS
FT                   HAAALEEAKRGRGITLAVAFAVAQDLATGALVRVPGRPVQGQGSWNISILGGERATPAA
FT                   EEMARFVTTPRATQAMLRGRGVTHGRFKPAVHVTLWS"
     MTPTQLRAFA TVVRLGSVKA AAAELEVSEA AVSLHVGQLR KELGDQLFNR TASGLAFTPG        60
     GLRLASRAVE LLGLQDRTVL EVREAGVGRR MLRLGTTSLF AEYAAPGLIG LFADRARDLD       120
     VELSVHRARD FEQLLLTRTV DAVVGPRPAT GDPALISKLF LNYQVLAVVG PEHPVTRGQP       180
     GIAMLRDQTW LLGPSAADDA GVIPGLLQRI GVPEERQQIF QSHAAALEEA KRGRGITLAV       240
     AFAVAQDLAT GALVRVPGRP VQGQGSWNIS ILGGERATPA AEEMARFVTT PRATQAMLRG       300
     RGVTHGRFKP AVHVTLWS                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page