(data stored in SCRATCH zone)

EMBL: CP000509.PE225

CP000509.PE225       Location/Qualifiers
FT   CDS             245931..248345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0230"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="KEGG: rha:RHA1_ro05232 possible carbon monoxide
FT                   dehydrogenase; TIGRFAM: carbon-monoxide dehydrogenase,
FT                   large subunit; PFAM: aldehyde oxidase and xanthine
FT                   dehydrogenase, a/b hammerhead; aldehyde oxidase and
FT                   xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79775"
FT                   /db_xref="GOA:A1SD90"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD90"
FT                   /protein_id="ABL79775.1"
FT                   /translation="MTATEPAPTTSRALDEIKIGGMGASRRRVEDNRFIRGRGHYVDDV
FT                   VLPGMLHMEILRSPVAHARIVSIDTTRAWNMPGVRLVLTGEMMATRNLAWMPTLSYDTQ
FT                   AVLATDKVRFQGQEVACVIADDPYIAKDACEAIEVEYEQLPVIVNPTQAMAPDAPIIRD
FT                   DKEGQADNVIFDWEVGDKEGTDRAFAEADHVSTIRMHYPRSHPSPLECCGSVADFDRAT
FT                   GKLTIYMTTQAPHIVRAAVALIAELPEHMIRIVSPDLGGGFGNKVPVYPGYVMTILASI
FT                   LLERPVKWIEDRSGNLISTGFGRDVYLEGELALRRDGKILAVRMHTDSDHGAFFGDAQP
FT                   SKFKIGLLHSTFSCYDIPTAHLTARGVYTNKAPGGVAYRCSFRVTEAMFFQERMMQAAA
FT                   DELGIDQAEFRRMNFVRDDDFPHRTPFGFLTDSGQYAKCLQVGLDAIDYEGFRREQAEA
FT                   AKQGRLLGIGISCMTEPLGAGNSREYDILGIKMFDSAELRVHMTGKAILRTGAKTQGQG
FT                   HETTWAQIVAHELGLPADDVVVEEGDTDTAPFGMGTYASRSTPVAGAAVAMVARKIRAK
FT                   ARKLAAHLLEVSEEDVEWELGRFYVRSAPDRGVTIQECAMAAYSNMPDGLEPGLEANAY
FT                   YDPPNLTWPFGCYIVTVEVDPMTGVWDVLRVVAVDDCGVRINPMIVEGQIMGGLTEAYA
FT                   MSSMQFITFDADGNCIGSNFMDYLLPTAWETPGYELHEVVTPCPHHPIGAKGIGECATV
FT                   GGPAAFVNAVMDALKQYGVRNVDMPLLPDRVHEAITQRHDVSGAPPIRTDA"
     MTATEPAPTT SRALDEIKIG GMGASRRRVE DNRFIRGRGH YVDDVVLPGM LHMEILRSPV        60
     AHARIVSIDT TRAWNMPGVR LVLTGEMMAT RNLAWMPTLS YDTQAVLATD KVRFQGQEVA       120
     CVIADDPYIA KDACEAIEVE YEQLPVIVNP TQAMAPDAPI IRDDKEGQAD NVIFDWEVGD       180
     KEGTDRAFAE ADHVSTIRMH YPRSHPSPLE CCGSVADFDR ATGKLTIYMT TQAPHIVRAA       240
     VALIAELPEH MIRIVSPDLG GGFGNKVPVY PGYVMTILAS ILLERPVKWI EDRSGNLIST       300
     GFGRDVYLEG ELALRRDGKI LAVRMHTDSD HGAFFGDAQP SKFKIGLLHS TFSCYDIPTA       360
     HLTARGVYTN KAPGGVAYRC SFRVTEAMFF QERMMQAAAD ELGIDQAEFR RMNFVRDDDF       420
     PHRTPFGFLT DSGQYAKCLQ VGLDAIDYEG FRREQAEAAK QGRLLGIGIS CMTEPLGAGN       480
     SREYDILGIK MFDSAELRVH MTGKAILRTG AKTQGQGHET TWAQIVAHEL GLPADDVVVE       540
     EGDTDTAPFG MGTYASRSTP VAGAAVAMVA RKIRAKARKL AAHLLEVSEE DVEWELGRFY       600
     VRSAPDRGVT IQECAMAAYS NMPDGLEPGL EANAYYDPPN LTWPFGCYIV TVEVDPMTGV       660
     WDVLRVVAVD DCGVRINPMI VEGQIMGGLT EAYAMSSMQF ITFDADGNCI GSNFMDYLLP       720
     TAWETPGYEL HEVVTPCPHH PIGAKGIGEC ATVGGPAAFV NAVMDALKQY GVRNVDMPLL       780
     PDRVHEAITQ RHDVSGAPPI RTDA                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page