(data stored in ACNUC1104 zone)

EMBL: CP000509.PE228

CP000509.PE228       Location/Qualifiers
FT   CDS             249839..250090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79778"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD93"
FT                   /protein_id="ABL79778.1"
FT                   /translation="MLWWIGNIVLLVAVVPVLVALLNRVLAALERIRGAADDILAGGGA
FT                   LAADLEDVPETMATTGATVEAVSQGAVRYAGSVAKLLG"
     MLWWIGNIVL LVAVVPVLVA LLNRVLAALE RIRGAADDIL AGGGALAADL EDVPETMATT        60
     GATVEAVSQG AVRYAGSVAK LLG                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page