(data stored in SCRATCH zone)

EMBL: CP000509.PE230

CP000509.PE230       Location/Qualifiers
FT   CDS             250590..250877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79780"
FT                   /db_xref="GOA:A1SD95"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD95"
FT                   /protein_id="ABL79780.1"
FT                   /translation="MTVLLTDTQESLWWGAVIGGFVVVLAVAALLTILVLEVRTIDTRV
FT                   ASVKATLLEAETNTNDTALIATTAAGVDAVLAEGLEHHLFLGRVLGKVRM"
     MTVLLTDTQE SLWWGAVIGG FVVVLAVAAL LTILVLEVRT IDTRVASVKA TLLEAETNTN        60
     DTALIATTAA GVDAVLAEGL EHHLFLGRVL GKVRM                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page