(data stored in ACNUC1104 zone)

EMBL: CP000509.PE232

CP000509.PE232       Location/Qualifiers
FT   CDS             complement(251277..251729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79782"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD97"
FT                   /protein_id="ABL79782.1"
FT                   /translation="MIRLGSLAGYPFDGPRVLAGWAPPAVPAVYAILYRPDTAREQYAV
FT                   IYVGHSEDLSAEGFPFRHPAAPCWVERAGGRFGVHVATYEIPGGQAGHRTQLAEELVSV
FT                   YRPQCNDRQFDATWREEWIGSYRAPTTGPLTTRRSPAGGESSTESA"
     MIRLGSLAGY PFDGPRVLAG WAPPAVPAVY AILYRPDTAR EQYAVIYVGH SEDLSAEGFP        60
     FRHPAAPCWV ERAGGRFGVH VATYEIPGGQ AGHRTQLAEE LVSVYRPQCN DRQFDATWRE       120
     EWIGSYRAPT TGPLTTRRSP AGGESSTESA                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page