(data stored in SCRATCH zone)

EMBL: CP000509.PE235

CP000509.PE235       Location/Qualifiers
FT   CDS             complement(253754..253996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA0"
FT                   /protein_id="ABL79785.1"
FT                   /translation="MAEPNEVLRALWDADEATEAAVELEHAAPAKVCKRTRGMTFDGMA
FT                   EPGTDLNEAWRDLLAREGKLGTGETIRDLVLGRDA"
     MAEPNEVLRA LWDADEATEA AVELEHAAPA KVCKRTRGMT FDGMAEPGTD LNEAWRDLLA        60
     REGKLGTGET IRDLVLGRDA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page