(data stored in SCRATCH zone)

EMBL: CP000509.PE241

CP000509.PE241       Location/Qualifiers
FT   CDS             258374..258877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79791"
FT                   /db_xref="GOA:A1SDA6"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA6"
FT                   /protein_id="ABL79791.1"
FT                   /translation="MKAVVRRVALEVLGWVLVVAGIAALVLPGPGLLMIFAGLVILSQE
FT                   YEWAERRVEPVKIRALRGAAEGVENWRRVTFSTAIAVGLVGCGAVWIWGPEAPGWWPVA
FT                   ERWWLPGGAATGVTQVASGFIAIGLIVYSYRRFRVRGEPVPELPDDDDDDNDDNDSRGA
FT                   AERD"
     MKAVVRRVAL EVLGWVLVVA GIAALVLPGP GLLMIFAGLV ILSQEYEWAE RRVEPVKIRA        60
     LRGAAEGVEN WRRVTFSTAI AVGLVGCGAV WIWGPEAPGW WPVAERWWLP GGAATGVTQV       120
     ASGFIAIGLI VYSYRRFRVR GEPVPELPDD DDDDNDDNDS RGAAERD                     167
//

If you have problems or comments...

PBIL Back to PBIL home page