(data stored in ACNUC1104 zone)

EMBL: CP000509.PE242

CP000509.PE242       Location/Qualifiers
FT   CDS             complement(259106..260992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0247"
FT                   /product="ATP-binding region, ATPase domain protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: sth:STH843 two-component sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79792"
FT                   /db_xref="GOA:A1SDA7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA7"
FT                   /protein_id="ABL79792.1"
FT                   /translation="MTTSPTAEGILGERARREAGPRLGGRAETVVDTEVVHHEDARAGW
FT                   SDSAARAVLQLMVESVAEMVGFEVATLSVVLDGDLVTMAYTGPEEFRDYLMAPDPVTVL
FT                   DPVLARAESWGRFHFLAAEDYDATTLEGHWMVVADGQVDVPDAWHPMDVLVGLLTDDDG
FT                   RLVGAMSVDRPVSGRRPDPAQRRLLERYAAQAERAVMTAFEREELVQQVAHSEAARRLI
FT                   RSASMPDQASLQAVLDHTHRPLVEGFGAAGSWLQVLDPDSGGVGYARTREGEVVSLSDR
FT                   MIALAHGLAPRLWEAQQVLVVAEGVEPSLSAESGAGPLLEEARRQIAELGLTSAMAVPL
FT                   GAGTECLGFLVLSRRAQDPPWSTVEIGSALQIGYDLGAALMTVRALERERSLVRELQQL
FT                   DDYRSQLIATLSHELRTPLTVISGNLELLGDLSLDETAQHYQEAMTRGTTRMQKVVDDL
FT                   LLLARVSDPQHPLVQVPVDLNAVTRTTVDLLTAPALAKGLSLRLQHNPREHLVPGDPGE
FT                   LDRLLTNLVSNAVKYTPAGGTVTVTVERRGDAAVLEVADDGLGISEEDQVGLFRPFFRT
FT                   TNPDALREPGTGLGLAIVATIVERHGGEVRVRSRLGVGTTFTVTFPAAAPAG"
     MTTSPTAEGI LGERARREAG PRLGGRAETV VDTEVVHHED ARAGWSDSAA RAVLQLMVES        60
     VAEMVGFEVA TLSVVLDGDL VTMAYTGPEE FRDYLMAPDP VTVLDPVLAR AESWGRFHFL       120
     AAEDYDATTL EGHWMVVADG QVDVPDAWHP MDVLVGLLTD DDGRLVGAMS VDRPVSGRRP       180
     DPAQRRLLER YAAQAERAVM TAFEREELVQ QVAHSEAARR LIRSASMPDQ ASLQAVLDHT       240
     HRPLVEGFGA AGSWLQVLDP DSGGVGYART REGEVVSLSD RMIALAHGLA PRLWEAQQVL       300
     VVAEGVEPSL SAESGAGPLL EEARRQIAEL GLTSAMAVPL GAGTECLGFL VLSRRAQDPP       360
     WSTVEIGSAL QIGYDLGAAL MTVRALERER SLVRELQQLD DYRSQLIATL SHELRTPLTV       420
     ISGNLELLGD LSLDETAQHY QEAMTRGTTR MQKVVDDLLL LARVSDPQHP LVQVPVDLNA       480
     VTRTTVDLLT APALAKGLSL RLQHNPREHL VPGDPGELDR LLTNLVSNAV KYTPAGGTVT       540
     VTVERRGDAA VLEVADDGLG ISEEDQVGLF RPFFRTTNPD ALREPGTGLG LAIVATIVER       600
     HGGEVRVRSR LGVGTTFTVT FPAAAPAG                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page