(data stored in ACNUC1104 zone)

EMBL: CP000509.PE248

CP000509.PE248       Location/Qualifiers
FT   CDS             270200..271954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0253"
FT                   /product="DNA helicase/exodeoxyribonuclease V, alpha
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: mpa:MAP4091c exodeoxyribonuclease V alpha
FT                   chain; TIGRFAM: exodeoxyribonuclease V, alpha subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79798"
FT                   /db_xref="GOA:A1SDB3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB3"
FT                   /protein_id="ABL79798.1"
FT                   /translation="MTELFEPVDEHDWRIATGATGLLATFNAAGVLTSSDVHVATRIGV
FT                   LGGETDERMLLAVALTVRAVRRGSVCLDLAGVAATAPDLPWPDEWPVAGSPLVHAGVVR
FT                   WDHELLYLDRYHRLERQVHDDLAARLALAPPAVDEQRLEAALARLGGGHFSEEQRAAVV
FT                   AAVRRRTTILTGGPGTGKTTTVARLLALLADQAAGRGSRLSIALAAPTGKAATRLQEAV
FT                   VTELAAVATAWPEAPALVGRLDGLTLHRLLGWRPDNATRFRHDRANRLKYDVVVVDESS
FT                   MVELTMMGRLLEALRPDSRLVLVGDPQQLTSVGAGAVLSDLVAGYEGRPDSPVAALSTN
FT                   FRSEEDIKSLAAALRSGDADEVIAVLRAPSEQVSWVETSDAAEVEAALRPDSLASARAV
FT                   WAAARDEDAERALAELDRYRLLCAHREGLYGVRRWNHLVERWLAEDPDVEIYDEWYVGR
FT                   PLLVTSNDYALDVYNGESGVVVRQDQRRRVFVAGSERLKEFAPGRLEAVETMHAMTIHK
FT                   SQGSQADRVSVLLPDEGSRLLTLELFYTAITRARHHVRVVGSEAAVRAAVDTRAQRATG
FT                   LRARLADG"
     MTELFEPVDE HDWRIATGAT GLLATFNAAG VLTSSDVHVA TRIGVLGGET DERMLLAVAL        60
     TVRAVRRGSV CLDLAGVAAT APDLPWPDEW PVAGSPLVHA GVVRWDHELL YLDRYHRLER       120
     QVHDDLAARL ALAPPAVDEQ RLEAALARLG GGHFSEEQRA AVVAAVRRRT TILTGGPGTG       180
     KTTTVARLLA LLADQAAGRG SRLSIALAAP TGKAATRLQE AVVTELAAVA TAWPEAPALV       240
     GRLDGLTLHR LLGWRPDNAT RFRHDRANRL KYDVVVVDES SMVELTMMGR LLEALRPDSR       300
     LVLVGDPQQL TSVGAGAVLS DLVAGYEGRP DSPVAALSTN FRSEEDIKSL AAALRSGDAD       360
     EVIAVLRAPS EQVSWVETSD AAEVEAALRP DSLASARAVW AAARDEDAER ALAELDRYRL       420
     LCAHREGLYG VRRWNHLVER WLAEDPDVEI YDEWYVGRPL LVTSNDYALD VYNGESGVVV       480
     RQDQRRRVFV AGSERLKEFA PGRLEAVETM HAMTIHKSQG SQADRVSVLL PDEGSRLLTL       540
     ELFYTAITRA RHHVRVVGSE AAVRAAVDTR AQRATGLRAR LADG                        584
//

If you have problems or comments...

PBIL Back to PBIL home page