(data stored in ACNUC1104 zone)

EMBL: CP000509.PE249

CP000509.PE249       Location/Qualifiers
FT   CDS             272008..272631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0254"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   pac:PPA1121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79799"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB4"
FT                   /protein_id="ABL79799.1"
FT                   /translation="MPYLLRVELPDVPGSLGRLATAIGEAGGDIEAIEIVEKRHGGTAV
FT                   DDVFLEMDPGAMPDSVVSTVNALDGVRVLWVGRYAAGGNLFLDLEAVEELTEDPEHALG
FT                   RLIDRLPVVFRADWAARVSKADGVVYATGAAPKELAWQPIERAETIGSADENNIHCAAR
FT                   LNKSEIVVIGRRGGPAFLDSEIARLGHLTGLAMSIARAARAATP"
     MPYLLRVELP DVPGSLGRLA TAIGEAGGDI EAIEIVEKRH GGTAVDDVFL EMDPGAMPDS        60
     VVSTVNALDG VRVLWVGRYA AGGNLFLDLE AVEELTEDPE HALGRLIDRL PVVFRADWAA       120
     RVSKADGVVY ATGAAPKELA WQPIERAETI GSADENNIHC AARLNKSEIV VIGRRGGPAF       180
     LDSEIARLGH LTGLAMSIAR AARAATP                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page