(data stored in SCRATCH zone)

EMBL: CP000509.PE250

CP000509.PE250       Location/Qualifiers
FT   CDS             complement(272737..274059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0255"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV5597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79800"
FT                   /db_xref="GOA:A1SDB5"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB5"
FT                   /protein_id="ABL79800.1"
FT                   /translation="MLHHAEVTATTPAPRSALAEPTTKPPGRWIAAITLASIGLWAGFF
FT                   GPIQVLLAQQAEAIAPDDKKVVLSVVLGLGAFVSVVCNPVFGAFSDRTTLRAGRRLPWI
FT                   AGGAVGGALSLLLLSVADNVVVMAIGWCGVQATLNAMLAAVTATVPDQVPVGERGRVGG
FT                   ILAVAQTVGVVGGTGIASATGSIAAGYVVTAGVLIVLTLPYCVGSRDVPLAPDELPPPF
FT                   DWGGFLRSFWVSPRRHPDFAWAWITRFLVNLGNALGLLYLLYYLQDVIGVDKDEADDRV
FT                   FLLTAIYAAVIMATTVVFGVWSDRTGKRKVFVIWSGVVGSLASLLLAVGQTWPAAVAAA
FT                   VLMGVGYGIYTSVDFALITQVLPGAEDRAKDLGVINIANALPQVFAPFIAAVILLVVEA
FT                   AGGVTETGGDRFSVGYCVLYSVAFLVAVLGSVFVTKIRSVP"
     MLHHAEVTAT TPAPRSALAE PTTKPPGRWI AAITLASIGL WAGFFGPIQV LLAQQAEAIA        60
     PDDKKVVLSV VLGLGAFVSV VCNPVFGAFS DRTTLRAGRR LPWIAGGAVG GALSLLLLSV       120
     ADNVVVMAIG WCGVQATLNA MLAAVTATVP DQVPVGERGR VGGILAVAQT VGVVGGTGIA       180
     SATGSIAAGY VVTAGVLIVL TLPYCVGSRD VPLAPDELPP PFDWGGFLRS FWVSPRRHPD       240
     FAWAWITRFL VNLGNALGLL YLLYYLQDVI GVDKDEADDR VFLLTAIYAA VIMATTVVFG       300
     VWSDRTGKRK VFVIWSGVVG SLASLLLAVG QTWPAAVAAA VLMGVGYGIY TSVDFALITQ       360
     VLPGAEDRAK DLGVINIANA LPQVFAPFIA AVILLVVEAA GGVTETGGDR FSVGYCVLYS       420
     VAFLVAVLGS VFVTKIRSVP                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page