(data stored in ACNUC1104 zone)

EMBL: CP000509.PE251

CP000509.PE251       Location/Qualifiers
FT   CDS             complement(274119..275576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79801"
FT                   /db_xref="GOA:A1SDB6"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB6"
FT                   /protein_id="ABL79801.1"
FT                   /translation="MRALTATLSLLLAGALAAPAAADPAPTDPAYTQRDAQNITDAYGR
FT                   IDGEGGQLRNPAYLPALVAASTQRGVDQLLTQVASPTRPALTPGNVFPGWNVGNPLRAG
FT                   WDGTRGVSRAVTFTNEYGAQLRGHVWKPLPGARDPYTGRRLHGPFPGVVITEGSVQGSE
FT                   GMYEWLAQDLAERGYVVLTYDVQGQGTSETFPHQESPVPVDGLPFCNPFAAPDDGEMSG
FT                   CPGVPSQQLSNFVVGTEAALDFITSRANPFRRSLDRSPDPHPATPGRTTRIAIIGHSMG
FT                   AAAVSKVQGTDRRVAAVVALDKLAGPDSSGALDGAGNRPVVPALAVQSEYGFTVSPWFL
FT                   SGGSSLSPQPSPDGPDPMRERATGYDAWRAAGVDAMLVVPRASTHLEYTDIPLVLPASR
FT                   YGQDLTSVYVQRWLDRYLKHRDDTAALLADSFRYLEPAGDGVWSPVRLHRDDLLSFYYC
FT                   SAYGLDTPRGEVADGDVTGVGCPSSIG"
     MRALTATLSL LLAGALAAPA AADPAPTDPA YTQRDAQNIT DAYGRIDGEG GQLRNPAYLP        60
     ALVAASTQRG VDQLLTQVAS PTRPALTPGN VFPGWNVGNP LRAGWDGTRG VSRAVTFTNE       120
     YGAQLRGHVW KPLPGARDPY TGRRLHGPFP GVVITEGSVQ GSEGMYEWLA QDLAERGYVV       180
     LTYDVQGQGT SETFPHQESP VPVDGLPFCN PFAAPDDGEM SGCPGVPSQQ LSNFVVGTEA       240
     ALDFITSRAN PFRRSLDRSP DPHPATPGRT TRIAIIGHSM GAAAVSKVQG TDRRVAAVVA       300
     LDKLAGPDSS GALDGAGNRP VVPALAVQSE YGFTVSPWFL SGGSSLSPQP SPDGPDPMRE       360
     RATGYDAWRA AGVDAMLVVP RASTHLEYTD IPLVLPASRY GQDLTSVYVQ RWLDRYLKHR       420
     DDTAALLADS FRYLEPAGDG VWSPVRLHRD DLLSFYYCSA YGLDTPRGEV ADGDVTGVGC       480
     PSSIG                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page