(data stored in SCRATCH zone)

EMBL: CP000509.PE252

CP000509.PE252       Location/Qualifiers
FT   CDS             complement(275612..276055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0257"
FT                   /product="Mycobacterium tuberculosis paralogous family 11"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: sma:SAV7465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79802"
FT                   /db_xref="GOA:A1SDB7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB7"
FT                   /protein_id="ABL79802.1"
FT                   /translation="MTLDGEYEPNPQQWVRDQVEEFEASNGQRANILMDHPEWPIVVIT
FT                   SRGATSGKLRKNPVMRVEKDGVYAAIASKGGTPEHPSWYHNFVAHPEVDLQDRSEKHSY
FT                   RARIAEGAERAEWWERAVAQYAPYAEYQEKTDREIPVFLLERV"
     MTLDGEYEPN PQQWVRDQVE EFEASNGQRA NILMDHPEWP IVVITSRGAT SGKLRKNPVM        60
     RVEKDGVYAA IASKGGTPEH PSWYHNFVAH PEVDLQDRSE KHSYRARIAE GAERAEWWER       120
     AVAQYAPYAE YQEKTDREIP VFLLERV                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page