(data stored in ACNUC1104 zone)

EMBL: CP000509.PE254

CP000509.PE254       Location/Qualifiers
FT   CDS             277105..278469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE1017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79804"
FT                   /db_xref="GOA:A1SDB9"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB9"
FT                   /protein_id="ABL79804.1"
FT                   /translation="MLRGQDGPQPVSRAESLYTALVRRNPETEQEMPAQVRRSIAPNGL
FT                   RQVLANALQSSGDQLVNASTVLPWLFGALGVPAALTGLLVPVRESGSMLPQAALTPLVL
FT                   RARYRKRIFVAGALVQAVAVASMAAIAALGSGLAAGLVIVASLVVFALGRCLCSIASKD
FT                   VQGRTIPKGERGQINGLATTAAGLVAITLGLAVRLLGGEDLSAGQLAGLLAAGAGLWVA
FT                   VAVVYTGIREPADDPAGGAPARSPADDADTWFTRSLRLLKEDEHFRDFVGVRSLLLVSS
FT                   LSPPFVVTLSTQAGAGGLAGLGGFIVASGVAALIGGRLFGRFADRSSRRLMSTGAGVAS
FT                   AVVIATVVVVAVPGSTGEGRSGNILFIGAYFLLTLMHTGVRVGRKTYVVDMAEGDRRTE
FT                   YVAVSNSAMGLILLVVGGVSSALAIVHISWALLFLAGMGLVGVVAGARLPEVEHR"
     MLRGQDGPQP VSRAESLYTA LVRRNPETEQ EMPAQVRRSI APNGLRQVLA NALQSSGDQL        60
     VNASTVLPWL FGALGVPAAL TGLLVPVRES GSMLPQAALT PLVLRARYRK RIFVAGALVQ       120
     AVAVASMAAI AALGSGLAAG LVIVASLVVF ALGRCLCSIA SKDVQGRTIP KGERGQINGL       180
     ATTAAGLVAI TLGLAVRLLG GEDLSAGQLA GLLAAGAGLW VAVAVVYTGI REPADDPAGG       240
     APARSPADDA DTWFTRSLRL LKEDEHFRDF VGVRSLLLVS SLSPPFVVTL STQAGAGGLA       300
     GLGGFIVASG VAALIGGRLF GRFADRSSRR LMSTGAGVAS AVVIATVVVV AVPGSTGEGR       360
     SGNILFIGAY FLLTLMHTGV RVGRKTYVVD MAEGDRRTEY VAVSNSAMGL ILLVVGGVSS       420
     ALAIVHISWA LLFLAGMGLV GVVAGARLPE VEHR                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page