(data stored in ACNUC1104 zone)

EMBL: CP000509.PE256

CP000509.PE256       Location/Qualifiers
FT   CDS             280460..281875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0261"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   mmc:Mmcs_0100 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79806"
FT                   /db_xref="GOA:A1SDC1"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC1"
FT                   /protein_id="ABL79806.1"
FT                   /translation="MSAVSISVGAYLVASLLFILSLAGLSRHESARNGVNYGIAGMALA
FT                   LAATVGLLVHDTDEALPLVLLVVAMTVGAAIGLWRARVVAMTGMPELIALLHSFVGLAA
FT                   VLVGWNGYLHDEGLTGSLFRIHSAEVVIGVFIGAVTFTGSIVANLKLSARMKSAPLMLP
FT                   GKNAINLGALAVFAALTVWFTASPNLGVLIAVTAVALALGWHLVASIGGGDMPVVVSML
FT                   NSYSGWAAAASGFLLDNNLLIVTGALVGSSGAYLSYIMCEAMNRSFISVIAGGFGIEVA
FT                   ASGDTDYGEHHEISAEEVAELLADASSVIITPGYGMAVAQAQYPVAELTSKLRARGVDV
FT                   RFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEINDDFPSTDVVLVIGANDTVNPAAL
FT                   EEPGSPIAGMPVLHVWEAKDVIVFKRSMAVGYAGVQNPLFFRDNTHMLFGDAKDRVEDI
FT                   VRQLSDIPQQVSR"
     MSAVSISVGA YLVASLLFIL SLAGLSRHES ARNGVNYGIA GMALALAATV GLLVHDTDEA        60
     LPLVLLVVAM TVGAAIGLWR ARVVAMTGMP ELIALLHSFV GLAAVLVGWN GYLHDEGLTG       120
     SLFRIHSAEV VIGVFIGAVT FTGSIVANLK LSARMKSAPL MLPGKNAINL GALAVFAALT       180
     VWFTASPNLG VLIAVTAVAL ALGWHLVASI GGGDMPVVVS MLNSYSGWAA AASGFLLDNN       240
     LLIVTGALVG SSGAYLSYIM CEAMNRSFIS VIAGGFGIEV AASGDTDYGE HHEISAEEVA       300
     ELLADASSVI ITPGYGMAVA QAQYPVAELT SKLRARGVDV RFGIHPVAGR LPGHMNVLLA       360
     EAKVPYDVVL EMDEINDDFP STDVVLVIGA NDTVNPAALE EPGSPIAGMP VLHVWEAKDV       420
     IVFKRSMAVG YAGVQNPLFF RDNTHMLFGD AKDRVEDIVR QLSDIPQQVS R                471
//

If you have problems or comments...

PBIL Back to PBIL home page