(data stored in SCRATCH zone)

EMBL: CP000509.PE259

CP000509.PE259       Location/Qualifiers
FT   CDS             283044..284195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0264"
FT                   /product="GTP-binding protein"
FT                   /note="KEGG: cya:CYA_2465 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79809"
FT                   /db_xref="GOA:A1SDC4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC4"
FT                   /protein_id="ABL79809.1"
FT                   /translation="MGTPADDWFGQAFSKAWRDKAEEIGRFNLAIFGKTGVGKSTLVNA
FT                   IFGSEIAATGIGEPVTRAEHLYLHQSGTLGVLDTRGLEVGRDNDALIAELKDYLHGMRR
FT                   RPLADQLHVAWYCVRAGDRRFEATEAEFVRALHELGLPVILVLTQVPRSIGPGGDARVH
FT                   PDAEALAASIAELRLPIVDGLIHYTMALEDDFTGQAAYGLQELLDATFRGAPEGVAHAI
FT                   TAAQRIDFVRKRERAEKAIKAATGAATTAGASPIPFSDAAILVPLQIGMMASIAVTYGV
FT                   PLERSTAASLAATAAATTAGRSLVTNLVKFVPGAGTMVAAPISATVAGTFTYAMGQAWL
FT                   RVCERLARGELGVVGGALDGESVRKVFLEEFKTQAARRRVGRR"
     MGTPADDWFG QAFSKAWRDK AEEIGRFNLA IFGKTGVGKS TLVNAIFGSE IAATGIGEPV        60
     TRAEHLYLHQ SGTLGVLDTR GLEVGRDNDA LIAELKDYLH GMRRRPLADQ LHVAWYCVRA       120
     GDRRFEATEA EFVRALHELG LPVILVLTQV PRSIGPGGDA RVHPDAEALA ASIAELRLPI       180
     VDGLIHYTMA LEDDFTGQAA YGLQELLDAT FRGAPEGVAH AITAAQRIDF VRKRERAEKA       240
     IKAATGAATT AGASPIPFSD AAILVPLQIG MMASIAVTYG VPLERSTAAS LAATAAATTA       300
     GRSLVTNLVK FVPGAGTMVA APISATVAGT FTYAMGQAWL RVCERLARGE LGVVGGALDG       360
     ESVRKVFLEE FKTQAARRRV GRR                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page