(data stored in SCRATCH zone)

EMBL: CP000509.PE26

CP000509.PE26        Location/Qualifiers
FT   CDS             complement(29771..31087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0026"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   sco:SCO3845 putative protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79576"
FT                   /db_xref="GOA:A1SCP1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP1"
FT                   /protein_id="ABL79576.1"
FT                   /translation="MTDTPAAAPSLRLRFAAISDVGRVRKDNQDSGYVGPWLVAVCDGV
FT                   GGAARGDIASSTAIAQLRRLDVSPSGESADDLLTKVAGALHRAHERINELAAEDPALDG
FT                   TSTTATVALFDGARVAMGHVGDSRAYLFRDGEITRLTSDHTFVQTLIDEGRITEAEARV
FT                   HPHRNLILNALGGPGDVEPDLFMIELAPKDRLLLCSDGASGVLDDDRLADILATGSPEF
FT                   ASVELVRASLEAGSSDNVTCLVADAVDAAEPPGPGEAEEPVLVGAAAERRLHRQRGGMG
FT                   SLFRGHRSGDTGELEPVQAEILDLPYAITADPIDPEEARYAPRPPRRFVWLKRLLTLVL
FT                   LVGLAWVGIAAAWSWTQGQYYVGEQDGTVVIFRGVNTELAGLSLSEPYESSDVELDRLG
FT                   EVEADRVREGIAYDNLEDAEQKVRDLAARQSPASESSAG"
     MTDTPAAAPS LRLRFAAISD VGRVRKDNQD SGYVGPWLVA VCDGVGGAAR GDIASSTAIA        60
     QLRRLDVSPS GESADDLLTK VAGALHRAHE RINELAAEDP ALDGTSTTAT VALFDGARVA       120
     MGHVGDSRAY LFRDGEITRL TSDHTFVQTL IDEGRITEAE ARVHPHRNLI LNALGGPGDV       180
     EPDLFMIELA PKDRLLLCSD GASGVLDDDR LADILATGSP EFASVELVRA SLEAGSSDNV       240
     TCLVADAVDA AEPPGPGEAE EPVLVGAAAE RRLHRQRGGM GSLFRGHRSG DTGELEPVQA       300
     EILDLPYAIT ADPIDPEEAR YAPRPPRRFV WLKRLLTLVL LVGLAWVGIA AAWSWTQGQY       360
     YVGEQDGTVV IFRGVNTELA GLSLSEPYES SDVELDRLGE VEADRVREGI AYDNLEDAEQ       420
     KVRDLAARQS PASESSAG                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page