(data stored in ACNUC1104 zone)

EMBL: CP000509.PE262

CP000509.PE262       Location/Qualifiers
FT   CDS             complement(285767..287506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0267"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="KEGG: nfa:nfa18050 putative glycosyl hydrolase;
FT                   TIGRFAM: malto-oligosyltrehalose trehalohydrolase; PFAM:
FT                   alpha amylase, catalytic region; SMART: alpha amylase,
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79812"
FT                   /db_xref="GOA:A1SDC7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC7"
FT                   /protein_id="ABL79812.1"
FT                   /translation="MTHGPFDVWAPLPRRLRLAVAGETVAMRRGEGDWWTPAGPVPAGA
FT                   ELDYGYLVDDGEAPRPDPRSRRQPGGVHQLSRTFDPASYPWTDQAWTGRQLAGSVVYEL
FT                   HVGTFTPEGTFDAALEKLPHLREIGVDLVELMPVNAFNGTHNWGYDGVGWFAVHEGYGG
FT                   PAGYQRFVDGCHAAGLGVIQDVVYNHLGPSGNYLPELGPYLKQGANTWGDFLNLDGPGS
FT                   DEVRRYILDNVRMWLADYHVDGLRLDAVHALNDAGHQHLLEELAAEVAALSAHQRRPLT
FT                   LIAESDLNDTRLVRPREAGGYGLDAQWSDDFHHAVHVALTGETAGYYADFEPLSALAKV
FT                   CERGFFHDGTWSSFRGRDHGFPVDLRTMPTWRLVVCSQNHDQIGNRARGDRITEVLDDD
FT                   QLACAALLTLCGPFTPMLFMGEEWAASTPFQFFTSHPEPDLGTATAEGRIAEFERMGWD
FT                   PAVVPDPQDPATFERSKLDWAEATRGRHARMLDVYRRLARLRREHEALTDPSFGSVRCT
FT                   ADEHTRVFTMRRGDLLVAVNFGDAAATVETAAATLLFQTGAGLTLDAGRLSLPPHAGAL
FT                   VGP"
     MTHGPFDVWA PLPRRLRLAV AGETVAMRRG EGDWWTPAGP VPAGAELDYG YLVDDGEAPR        60
     PDPRSRRQPG GVHQLSRTFD PASYPWTDQA WTGRQLAGSV VYELHVGTFT PEGTFDAALE       120
     KLPHLREIGV DLVELMPVNA FNGTHNWGYD GVGWFAVHEG YGGPAGYQRF VDGCHAAGLG       180
     VIQDVVYNHL GPSGNYLPEL GPYLKQGANT WGDFLNLDGP GSDEVRRYIL DNVRMWLADY       240
     HVDGLRLDAV HALNDAGHQH LLEELAAEVA ALSAHQRRPL TLIAESDLND TRLVRPREAG       300
     GYGLDAQWSD DFHHAVHVAL TGETAGYYAD FEPLSALAKV CERGFFHDGT WSSFRGRDHG       360
     FPVDLRTMPT WRLVVCSQNH DQIGNRARGD RITEVLDDDQ LACAALLTLC GPFTPMLFMG       420
     EEWAASTPFQ FFTSHPEPDL GTATAEGRIA EFERMGWDPA VVPDPQDPAT FERSKLDWAE       480
     ATRGRHARML DVYRRLARLR REHEALTDPS FGSVRCTADE HTRVFTMRRG DLLVAVNFGD       540
     AAATVETAAA TLLFQTGAGL TLDAGRLSLP PHAGALVGP                              579
//

If you have problems or comments...

PBIL Back to PBIL home page