(data stored in ACNUC1104 zone)

EMBL: CP000509.PE266

CP000509.PE266       Location/Qualifiers
FT   CDS             293627..294772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0271"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   rha:RHA1_ro08138 long-chain-acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79816"
FT                   /db_xref="GOA:A1SDD1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD1"
FT                   /protein_id="ABL79816.1"
FT                   /translation="MKRSIYDDDHEAFRDSVREFLERSVIPQVEQHAADKAIPRDFWTE
FT                   AGRQGFLGLEIPEEYGGAEAGDYRFNAVLLEELNKVNAALGSCVGIHADITAPYLVELG
FT                   TDEQKQRWLPGVAAGEVLLAIGMTEPSGGSDLAALKTTAVKDGDSWVINGSKTFITNGY
FT                   SADLVLVAARTSPEKKARGITLFAVESTAPGYSRGRKLDKIGQDESDTAELFFENVRVT
FT                   DAEIVGELDGGFIHMMQKLPQERLGCAISNVAHAKQILLETLQYAKDRKAFGQGIGSFQ
FT                   YNKFLLAELFTRIEVTEAFIDQCVVAHAAGELTPIDAAKAKWWSSQVQNEVLDHCVQLH
FT                   GGYGYMNEYRVARAWRDARVSKIWAGSNEIMKELIGRDLGL"
     MKRSIYDDDH EAFRDSVREF LERSVIPQVE QHAADKAIPR DFWTEAGRQG FLGLEIPEEY        60
     GGAEAGDYRF NAVLLEELNK VNAALGSCVG IHADITAPYL VELGTDEQKQ RWLPGVAAGE       120
     VLLAIGMTEP SGGSDLAALK TTAVKDGDSW VINGSKTFIT NGYSADLVLV AARTSPEKKA       180
     RGITLFAVES TAPGYSRGRK LDKIGQDESD TAELFFENVR VTDAEIVGEL DGGFIHMMQK       240
     LPQERLGCAI SNVAHAKQIL LETLQYAKDR KAFGQGIGSF QYNKFLLAEL FTRIEVTEAF       300
     IDQCVVAHAA GELTPIDAAK AKWWSSQVQN EVLDHCVQLH GGYGYMNEYR VARAWRDARV       360
     SKIWAGSNEI MKELIGRDLG L                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page