(data stored in ACNUC1104 zone)

EMBL: CP000509.PE269

CP000509.PE269       Location/Qualifiers
FT   CDS             complement(296357..297100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0274"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: lxx:Lxx23800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79819"
FT                   /db_xref="GOA:A1SDD4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD4"
FT                   /protein_id="ABL79819.1"
FT                   /translation="MTEAGSGQGGEDLRRFMLEHRFGMDEIVTKLTILRDEFTHLRDYN
FT                   PIESVSSRLKSPESLVEKMLRKGLVLDERPSFDQIRATVTDIAGVRVVCSFVSDVYRVF
FT                   DMLVEQEDVSTVEVRDYIATPKPNGYRSLHALVEVPVFLSEGPVPVLVEVQFRTIAMDF
FT                   WASLEHKIYYKYRREVPAELLERLHDAAETAYALDATMERLHEEVRGLDELPPDVLAQL
FT                   RDGGERPDAALREALRKLGATPETA"
     MTEAGSGQGG EDLRRFMLEH RFGMDEIVTK LTILRDEFTH LRDYNPIESV SSRLKSPESL        60
     VEKMLRKGLV LDERPSFDQI RATVTDIAGV RVVCSFVSDV YRVFDMLVEQ EDVSTVEVRD       120
     YIATPKPNGY RSLHALVEVP VFLSEGPVPV LVEVQFRTIA MDFWASLEHK IYYKYRREVP       180
     AELLERLHDA AETAYALDAT MERLHEEVRG LDELPPDVLA QLRDGGERPD AALREALRKL       240
     GATPETA                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page