(data stored in ACNUC1104 zone)

EMBL: CP000509.PE271

CP000509.PE271       Location/Qualifiers
FT   CDS             298300..298785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79821"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD6"
FT                   /protein_id="ABL79821.1"
FT                   /translation="MADQVDGIDFALAAYREGGAWTVQELAHDVLEDIDTLSAALRRFP
FT                   GDGGAVGMVAIEEDFFVVVRVAGPTTRVLLSDITAADEWELASSAVEFLGLPLPEDEDD
FT                   PVPAGDLDLLGDLGMHAMDMGVLLDDIDLYPDEMLSDVARRLGFGKLFDDAVGLTSA"
     MADQVDGIDF ALAAYREGGA WTVQELAHDV LEDIDTLSAA LRRFPGDGGA VGMVAIEEDF        60
     FVVVRVAGPT TRVLLSDITA ADEWELASSA VEFLGLPLPE DEDDPVPAGD LDLLGDLGMH       120
     AMDMGVLLDD IDLYPDEMLS DVARRLGFGK LFDDAVGLTS A                           161
//

If you have problems or comments...

PBIL Back to PBIL home page