(data stored in ACNUC1104 zone)

EMBL: CP000509.PE273

CP000509.PE273       Location/Qualifiers
FT   CDS             299282..299674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0278"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: lxx:Lxx15560 lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79823"
FT                   /db_xref="GOA:A1SDD8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD8"
FT                   /protein_id="ABL79823.1"
FT                   /translation="MHSYRGAMDYKIELIPLAVRDVDRSIAFYGDSLGWSVDHDQTVSP
FT                   TLRFVQVTPPGSACSICFGVGLEMMPAGSSQFIQVVVADADAALAELRERGVGCEGVDD
FT                   QPWGRFVYFQDPDGNRWALQQVVRPS"
     MHSYRGAMDY KIELIPLAVR DVDRSIAFYG DSLGWSVDHD QTVSPTLRFV QVTPPGSACS        60
     ICFGVGLEMM PAGSSQFIQV VVADADAALA ELRERGVGCE GVDDQPWGRF VYFQDPDGNR       120
     WALQQVVRPS                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page