(data stored in ACNUC1104 zone)

EMBL: CP000509.PE279

CP000509.PE279       Location/Qualifiers
FT   CDS             complement(304960..305166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0284"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: fra:Francci3_4502 putative signal-transduction
FT                   protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79829"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE4"
FT                   /protein_id="ABL79829.1"
FT                   /translation="MHATKGDHLVIHGTHVGEPLRDGEIVEVRGPDGAPPYVVRWADNG
FT                   HESLTYPGPDAEVHHLHHKGEGG"
     MHATKGDHLV IHGTHVGEPL RDGEIVEVRG PDGAPPYVVR WADNGHESLT YPGPDAEVHH        60
     LHHKGEGG                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page