(data stored in SCRATCH zone)

EMBL: CP000509.PE280

CP000509.PE280       Location/Qualifiers
FT   CDS             complement(305359..305565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0285"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: sco:SCO0174 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79830"
FT                   /db_xref="GOA:A1SDE5"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE5"
FT                   /protein_id="ABL79830.1"
FT                   /translation="MYAIKGDRLLVQGIRAGEPLRDGEIIAVHGDQGAPPYLVRWTDDG
FT                   HVSLTYPGPDAWIQHFVHAPGRD"
     MYAIKGDRLL VQGIRAGEPL RDGEIIAVHG DQGAPPYLVR WTDDGHVSLT YPGPDAWIQH        60
     FVHAPGRD                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page