(data stored in ACNUC1104 zone)

EMBL: CP000509.PE281

CP000509.PE281       Location/Qualifiers
FT   CDS             305919..306359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79831"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE6"
FT                   /protein_id="ABL79831.1"
FT                   /translation="MRPALLALLAALLALAVAPYPQPSAAASCVAPYLVEDGQLVLQRG
FT                   VRTEVEGEAFVDGCRDTMSCSAGPGCEDCHYNDPEPVPYDDVVLRLRQGGHTWVLGSAD
FT                   ADRAEDGLAGRVSWQVDLPAGVRPGPARLLADHAHPVVVRIR"
     MRPALLALLA ALLALAVAPY PQPSAAASCV APYLVEDGQL VLQRGVRTEV EGEAFVDGCR        60
     DTMSCSAGPG CEDCHYNDPE PVPYDDVVLR LRQGGHTWVL GSADADRAED GLAGRVSWQV       120
     DLPAGVRPGP ARLLADHAHP VVVRIR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page