(data stored in ACNUC1104 zone)

EMBL: CP000509.PE285

CP000509.PE285       Location/Qualifiers
FT   CDS             complement(308206..308595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79835"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF0"
FT                   /protein_id="ABL79835.1"
FT                   /translation="MPHRIPRRTRLALGAVKLTVVAATVVAGLSTPVTQAGAGYAGHRV
FT                   GEVADLPSPVARILAKHDCSTSGFADAAPASAVIRTATGRFRHVSFDEGWAVYTRRGAA
FT                   SLVAVCLDRAPEDREPTKAREPRPR"
     MPHRIPRRTR LALGAVKLTV VAATVVAGLS TPVTQAGAGY AGHRVGEVAD LPSPVARILA        60
     KHDCSTSGFA DAAPASAVIR TATGRFRHVS FDEGWAVYTR RGAASLVAVC LDRAPEDREP       120
     TKAREPRPR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page