(data stored in ACNUC1104 zone)

EMBL: CP000509.PE289

CP000509.PE289       Location/Qualifiers
FT   CDS             complement(312521..312925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79839"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF4"
FT                   /protein_id="ABL79839.1"
FT                   /translation="MYGDTGTIRALAARLRERADEIRAEAARLLARAEQVPWEGLAAEA
FT                   MRGHARDRVAALARTAALHEDAADALDRHAREVDRVKDLIAAIERKVRGLLSGLKDRLV
FT                   PDALDGVLHRFVPPLPGSRDWLDVDLPGLG"
     MYGDTGTIRA LAARLRERAD EIRAEAARLL ARAEQVPWEG LAAEAMRGHA RDRVAALART        60
     AALHEDAADA LDRHAREVDR VKDLIAAIER KVRGLLSGLK DRLVPDALDG VLHRFVPPLP       120
     GSRDWLDVDL PGLG                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page