(data stored in ACNUC1104 zone)

EMBL: CP000509.PE29

CP000509.PE29        Location/Qualifiers
FT   CDS             32794..33363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0029"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; FR47 domain
FT                   protein; KEGG: sco:SCO4496 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79579"
FT                   /db_xref="GOA:A1SCP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP4"
FT                   /protein_id="ABL79579.1"
FT                   /translation="MDACDGGPRGGYGPRVTTDLTASWPAQSTDELRAGLQGLLRDVVR
FT                   AGGAVGWLEPPGRADTDSWLDRLTAQQQAGDAGLVVIGDPVAPLAMGTWRRVDRQVHRH
FT                   VAEIAKVMSHPRARGRGLGRRVTTELLAALPAAGIEIVTLATRGNNHAAMALYTSLGFR
FT                   EYGRIPDGIMVGDDRYDDVRFVLSIE"
     MDACDGGPRG GYGPRVTTDL TASWPAQSTD ELRAGLQGLL RDVVRAGGAV GWLEPPGRAD        60
     TDSWLDRLTA QQQAGDAGLV VIGDPVAPLA MGTWRRVDRQ VHRHVAEIAK VMSHPRARGR       120
     GLGRRVTTEL LAALPAAGIE IVTLATRGNN HAAMALYTSL GFREYGRIPD GIMVGDDRYD       180
     DVRFVLSIE                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page