(data stored in SCRATCH zone)

EMBL: CP000509.PE291

CP000509.PE291       Location/Qualifiers
FT   CDS             complement(314330..315811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0296"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mbo:Mb1848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79841"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF6"
FT                   /protein_id="ABL79841.1"
FT                   /translation="MGRGTDIPAVLPAELLADAPSYDVVVVGFGIAGGCAALEAARAGA
FT                   RVLLLERAAVHGGTSSLSGGHFYLGGGTAVQVATGHDDTPEEMYKYLVAVSKEPEHDKI
FT                   RAYCEGSVEHFDWLEALGFEFERTYYPEKAVIQPGTEGLMYTGNEKVWPYREQARPAPR
FT                   GHKVPVPGDTEGTRMVMDLLHERVEEAGVEVRYETGATNLVADGSGTVRGLAWRSFEET
FT                   GYVAAAGVVIAAGGFVMNPDMVAAHTPRLAEKPFTLGSTYDDGLGIRLGASAGAELKHM
FT                   DEPFITAPFYPPSALVTGFLVNKLGERFCAEDSYHSRTSQFVMEQPDSTAYLIVDSEHV
FT                   EYPKFPLVPLIDGFETISELEDALELPAGSVAKTLERYNELAEAGEDADFHKAPEWLAP
FT                   QGAGPWAVFDLRLGHAMYAGFTLGGLRVSVDGEVERPDGSVIPGLYAAGACASNIAQDG
FT                   KGYCSGTQLGEGSFFGRRSGRAAAASASAASTGSG"
     MGRGTDIPAV LPAELLADAP SYDVVVVGFG IAGGCAALEA ARAGARVLLL ERAAVHGGTS        60
     SLSGGHFYLG GGTAVQVATG HDDTPEEMYK YLVAVSKEPE HDKIRAYCEG SVEHFDWLEA       120
     LGFEFERTYY PEKAVIQPGT EGLMYTGNEK VWPYREQARP APRGHKVPVP GDTEGTRMVM       180
     DLLHERVEEA GVEVRYETGA TNLVADGSGT VRGLAWRSFE ETGYVAAAGV VIAAGGFVMN       240
     PDMVAAHTPR LAEKPFTLGS TYDDGLGIRL GASAGAELKH MDEPFITAPF YPPSALVTGF       300
     LVNKLGERFC AEDSYHSRTS QFVMEQPDST AYLIVDSEHV EYPKFPLVPL IDGFETISEL       360
     EDALELPAGS VAKTLERYNE LAEAGEDADF HKAPEWLAPQ GAGPWAVFDL RLGHAMYAGF       420
     TLGGLRVSVD GEVERPDGSV IPGLYAAGAC ASNIAQDGKG YCSGTQLGEG SFFGRRSGRA       480
     AAASASAAST GSG                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page