(data stored in ACNUC1104 zone)

EMBL: CP000509.PE292

CP000509.PE292       Location/Qualifiers
FT   CDS             316135..316833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0297"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: fal:FRAAL5492
FT                   hypothetical protein; putative thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79842"
FT                   /db_xref="GOA:A1SDF7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF7"
FT                   /protein_id="ABL79842.1"
FT                   /translation="MRDVDGAELSFDAWSGHKRVLVVWASWCGCRYELGGWQRLQAELA
FT                   DAGLRLFSVALDADPEDARPWIEAAAPTYPVGVDTAHVTAERYGITNVPSVVWVDERDR
FT                   IVKPPTIAPGDDRFVEFTRIESARHHDLLRAWVREGVLPEPAESAPERSDAEQLALAHR
FT                   RIAAHHQRSGRTGAAQAQLARAQELAPWDWTVRRGGIAMTGGDPFLGPEFTAFWEVWDA
FT                   AGRPGYTPTG"
     MRDVDGAELS FDAWSGHKRV LVVWASWCGC RYELGGWQRL QAELADAGLR LFSVALDADP        60
     EDARPWIEAA APTYPVGVDT AHVTAERYGI TNVPSVVWVD ERDRIVKPPT IAPGDDRFVE       120
     FTRIESARHH DLLRAWVREG VLPEPAESAP ERSDAEQLAL AHRRIAAHHQ RSGRTGAAQA       180
     QLARAQELAP WDWTVRRGGI AMTGGDPFLG PEFTAFWEVW DAAGRPGYTP TG               232
//

If you have problems or comments...

PBIL Back to PBIL home page