(data stored in ACNUC1104 zone)

EMBL: CP000509.PE293

CP000509.PE293       Location/Qualifiers
FT   CDS             316905..318422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0298"
FT                   /product="potassium/proton antiporter, CPA1 family"
FT                   /note="PFAM: TrkA-C domain protein; sodium/hydrogen
FT                   exchanger; KEGG: sco:SCO3185 putative Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79843"
FT                   /db_xref="GOA:A1SDF8"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF8"
FT                   /protein_id="ABL79843.1"
FT                   /translation="MSFDVHDLDTFILVGSAVTLLAILAVRVSTGAGLPSLLIYLLMGA
FT                   ALGESGVGIQFENYEVAHAVGFAALAMILAEGGLTTNWPEMRGCIRLGVSLATLGVAVS
FT                   VTVVAVGAHYLLGMPWQLAVLLGAVTSPTDAAAVFSVLRVVPLPKRLTGTLEAESGLND
FT                   APTVVLVTLISSGAVEDNGALAMVGIVGYELAIGVALGLAAGYGGAWVMRRAALPSSGL
FT                   YPLAVMTLAFLGYGAAAFVHGSGFAAVYVAALVLGNSELPHRAATRSFAEGLAWLSQIG
FT                   LFVTLGLLLSPGRISLSTVGLAIVAGLVLTFVARPLSVLASAVVQPLPWRELSFVSWAG
FT                   LRGAVPIVLTTIPLAEGVDDAERLFDLVFVMVVLYTVLTGPTLPLVARVLRVARRSEPR
FT                   GLEVEAAPLERIAADLLQVSIAPGSRMHGVEVGELRLPRGASVSMVIRDGNTLVPERRT
FT                   VLRQGDDLLVVTPRKLRWQTEERLRQVSARGRLAQWLVEKPARRPQP"
     MSFDVHDLDT FILVGSAVTL LAILAVRVST GAGLPSLLIY LLMGAALGES GVGIQFENYE        60
     VAHAVGFAAL AMILAEGGLT TNWPEMRGCI RLGVSLATLG VAVSVTVVAV GAHYLLGMPW       120
     QLAVLLGAVT SPTDAAAVFS VLRVVPLPKR LTGTLEAESG LNDAPTVVLV TLISSGAVED       180
     NGALAMVGIV GYELAIGVAL GLAAGYGGAW VMRRAALPSS GLYPLAVMTL AFLGYGAAAF       240
     VHGSGFAAVY VAALVLGNSE LPHRAATRSF AEGLAWLSQI GLFVTLGLLL SPGRISLSTV       300
     GLAIVAGLVL TFVARPLSVL ASAVVQPLPW RELSFVSWAG LRGAVPIVLT TIPLAEGVDD       360
     AERLFDLVFV MVVLYTVLTG PTLPLVARVL RVARRSEPRG LEVEAAPLER IAADLLQVSI       420
     APGSRMHGVE VGELRLPRGA SVSMVIRDGN TLVPERRTVL RQGDDLLVVT PRKLRWQTEE       480
     RLRQVSARGR LAQWLVEKPA RRPQP                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page