(data stored in ACNUC1104 zone)

EMBL: CP000509.PE294

CP000509.PE294       Location/Qualifiers
FT   CDS             complement(318446..318946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA2178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79844"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF9"
FT                   /protein_id="ABL79844.1"
FT                   /translation="MPQGARSAITISALGLLLVVAALWGWSAATDPLPAKVDTPICVDR
FT                   TVAAGTKVFAQDVTVSVYNAGTREGLAGRTMQLLTDDGFAEGNSGNVSARVEVVQIWTL
FT                   DPTNPAVQLVASRLGPDVEIERRDGPGAGISIVVGDGFQDLVEGRRSVQAEDDATICSP
FT                   PVG"
     MPQGARSAIT ISALGLLLVV AALWGWSAAT DPLPAKVDTP ICVDRTVAAG TKVFAQDVTV        60
     SVYNAGTREG LAGRTMQLLT DDGFAEGNSG NVSARVEVVQ IWTLDPTNPA VQLVASRLGP       120
     DVEIERRDGP GAGISIVVGD GFQDLVEGRR SVQAEDDATI CSPPVG                      166
//

If you have problems or comments...

PBIL Back to PBIL home page