(data stored in ACNUC1104 zone)

EMBL: CP000509.PE295

CP000509.PE295       Location/Qualifiers
FT   CDS             complement(318946..319242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79845"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG0"
FT                   /protein_id="ABL79845.1"
FT                   /translation="MIFKRVGDGRPYPDHGLSSRAWAAVPPRQVRLDQLVTTKDTLQLA
FT                   ALLDEDSTFYGDLFAHVVEWRGDLYLEDGLHRALRAALQQRNVLHARVHTLED"
     MIFKRVGDGR PYPDHGLSSR AWAAVPPRQV RLDQLVTTKD TLQLAALLDE DSTFYGDLFA        60
     HVVEWRGDLY LEDGLHRALR AALQQRNVLH ARVHTLED                                98
//

If you have problems or comments...

PBIL Back to PBIL home page