(data stored in ACNUC1104 zone)

EMBL: CP000509.PE298

CP000509.PE298       Location/Qualifiers
FT   CDS             complement(320191..324171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0303"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5734 ATP/GTP binding protein (membrane
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79848"
FT                   /db_xref="GOA:A1SDG3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG3"
FT                   /protein_id="ABL79848.1"
FT                   /translation="MSTTLRGTRLDAPELPTGQVVLQPPPRIEPNEGASGVLMNAIPML
FT                   GSLGSIVLVATMGRASGGRGFLAAGMFLFATLGFIVVQLDRQRKQRTQQVSGSRTEYLR
FT                   YLANVRKVAREAADQQRRALTWQHPDPSALPALADERSRVWEHTTSDPTFLHVRYGVCA
FT                   QPLSLELVPPESTPIDQVDPAAASALHRLLVVHRLQPDLPASIDLRAFDRIEVCGPEEP
FT                   ARSLARSLICSATVFHSPDQLAVAVLTSEQHLARWDWLKWLPHAQSGRLSDAVGPMRMV
FT                   STSLADLAALLPADLGERPRFGADERPATPHLLLVVDDGELPPGNHVVPPDGLHGVTLL
FT                   DLPARWDDLEDATRLRLQLTAEPADDGRHPVLALRLREQPIRARADQCSIATAEALARR
FT                   LTPLHTIAAGGVEPGTGEIAGTADYLELLALGDVHTLDPATAWRPRPARDRLRVPIGLG
FT                   EGGSVVHLDIKESAQQGMGPHGLVIGATGSGKSEFLRTLVLGLALTHSPEQLNMVLVDF
FT                   KGGATFAGMADLPHVSAVITNLAQELTLVDRMQDALSGEMVRRQELLREAGNYASVRDY
FT                   ERARVAGEDLVPLPSLFIVVDEFSEMLSAKPEFIDLFVAIGRLGRSLGLHLLLASQRLE
FT                   EGRLRGLESHLSYRIGLRTFSAGESRTVLGVPDAYELPADPGLGYLKPDPATMLRFKAA
FT                   YVSGPPSGRVRVRRDEGGHLRGILPFTIAEVQALDVADPEPEPVAVEQPGDQESLLDLA
FT                   VRRMVGHGPAAHQVWLPPLDVPDTLDDLMPDLTEDPRHGLVSAHWRQLGGLIVPLGTAD
FT                   RPREQRRDTFTVDLGGSGGHAAVVGGPRSGKSTLLRTMVASISLTTTPQESQFFVLDFG
FT                   GGTFTPYADLPHVAGVGTRSEPDVVRRIVAEVRGVVDRREAYFRAHGIDSIETYRSRRA
FT                   AGRADDGYGDVFLVVDGWSTLRADFDDLELELQQLATRGLTFGLHLLVGAARWADFRAA
FT                   VRDLFGTRLELRLGDPMDSEIDRKVAALVPAGRPGRGLTASRLHFLAALPRVDGSADVE
FT                   ALGDGVDHLVKRVAAAWAGPTGPKLRLLPERIGLDDVRTLARPAAEDRRLLLGVTESDL
FT                   GPVALDGDAEPHLLVFGDGRSGKSALLRAYAREVMRTRTPQQAQLVVVDYRRSLLGEVP
FT                   EEYLVDYLTSARLAQPALQDLASYLESRIPGPDVTPDQLRNRSWWTGAEVFVLVDDYDL
FT                   VATQQGSPVQALQPLLPQARDLGLHLVVARRSGGASRALYEPVIQSLRDLAMPGLLLSG
FT                   SPDEGPLLGTHKPQPAPPGRGRLVTRDRGAEVVQLAWCEPSL"
     MSTTLRGTRL DAPELPTGQV VLQPPPRIEP NEGASGVLMN AIPMLGSLGS IVLVATMGRA        60
     SGGRGFLAAG MFLFATLGFI VVQLDRQRKQ RTQQVSGSRT EYLRYLANVR KVAREAADQQ       120
     RRALTWQHPD PSALPALADE RSRVWEHTTS DPTFLHVRYG VCAQPLSLEL VPPESTPIDQ       180
     VDPAAASALH RLLVVHRLQP DLPASIDLRA FDRIEVCGPE EPARSLARSL ICSATVFHSP       240
     DQLAVAVLTS EQHLARWDWL KWLPHAQSGR LSDAVGPMRM VSTSLADLAA LLPADLGERP       300
     RFGADERPAT PHLLLVVDDG ELPPGNHVVP PDGLHGVTLL DLPARWDDLE DATRLRLQLT       360
     AEPADDGRHP VLALRLREQP IRARADQCSI ATAEALARRL TPLHTIAAGG VEPGTGEIAG       420
     TADYLELLAL GDVHTLDPAT AWRPRPARDR LRVPIGLGEG GSVVHLDIKE SAQQGMGPHG       480
     LVIGATGSGK SEFLRTLVLG LALTHSPEQL NMVLVDFKGG ATFAGMADLP HVSAVITNLA       540
     QELTLVDRMQ DALSGEMVRR QELLREAGNY ASVRDYERAR VAGEDLVPLP SLFIVVDEFS       600
     EMLSAKPEFI DLFVAIGRLG RSLGLHLLLA SQRLEEGRLR GLESHLSYRI GLRTFSAGES       660
     RTVLGVPDAY ELPADPGLGY LKPDPATMLR FKAAYVSGPP SGRVRVRRDE GGHLRGILPF       720
     TIAEVQALDV ADPEPEPVAV EQPGDQESLL DLAVRRMVGH GPAAHQVWLP PLDVPDTLDD       780
     LMPDLTEDPR HGLVSAHWRQ LGGLIVPLGT ADRPREQRRD TFTVDLGGSG GHAAVVGGPR       840
     SGKSTLLRTM VASISLTTTP QESQFFVLDF GGGTFTPYAD LPHVAGVGTR SEPDVVRRIV       900
     AEVRGVVDRR EAYFRAHGID SIETYRSRRA AGRADDGYGD VFLVVDGWST LRADFDDLEL       960
     ELQQLATRGL TFGLHLLVGA ARWADFRAAV RDLFGTRLEL RLGDPMDSEI DRKVAALVPA      1020
     GRPGRGLTAS RLHFLAALPR VDGSADVEAL GDGVDHLVKR VAAAWAGPTG PKLRLLPERI      1080
     GLDDVRTLAR PAAEDRRLLL GVTESDLGPV ALDGDAEPHL LVFGDGRSGK SALLRAYARE      1140
     VMRTRTPQQA QLVVVDYRRS LLGEVPEEYL VDYLTSARLA QPALQDLASY LESRIPGPDV      1200
     TPDQLRNRSW WTGAEVFVLV DDYDLVATQQ GSPVQALQPL LPQARDLGLH LVVARRSGGA      1260
     SRALYEPVIQ SLRDLAMPGL LLSGSPDEGP LLGTHKPQPA PPGRGRLVTR DRGAEVVQLA      1320
     WCEPSL                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page