(data stored in ACNUC1104 zone)

EMBL: CP000509.PE299

CP000509.PE299       Location/Qualifiers
FT   CDS             324276..325691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79849"
FT                   /db_xref="GOA:A1SDG4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG4"
FT                   /protein_id="ABL79849.1"
FT                   /translation="MAGTHAPADILALSVHGPVGVLDLVVPGTATAADVAEEYAVRAGL
FT                   DAAPVLRSRLGHGLEPATTLARAGVVTGDLLVADPSAPGVPADRAAEPVAGGRHAARSG
FT                   PAADGSPRPRPDTLPMLGLAVAAAAAGLAGWCAATAPGGALRATAIGLLLVAAVLGVLP
FT                   IGRRAAHRVVAAPAFGAAAAFAMAWDPHGVRLPMVLGVTGLAAALVAAVGRALAARPGE
FT                   ALRVWVLAGVAGFVGTGLASLGGAPPRLVWSLVLLGALLAARFVPAVAVDVPDQYLIDL
FT                   DRLAVTAWSAREQPSGRRGRTVVPLDAVDAVAARGTRIVTAASAAVLAAVLLSAPLLLA
FT                   AATLPIDRVGARVLVGCAGAGLLLAARSYRHAAARALLRIAGLACGTVLATALLGAAGR
FT                   AGWWLAGLAVLTAAALVVAAVAVGRGWRSAWWSRRAEVAEGLAGATAVGALVVASGWFR
FT                   QLWELASLWKLGA"
     MAGTHAPADI LALSVHGPVG VLDLVVPGTA TAADVAEEYA VRAGLDAAPV LRSRLGHGLE        60
     PATTLARAGV VTGDLLVADP SAPGVPADRA AEPVAGGRHA ARSGPAADGS PRPRPDTLPM       120
     LGLAVAAAAA GLAGWCAATA PGGALRATAI GLLLVAAVLG VLPIGRRAAH RVVAAPAFGA       180
     AAAFAMAWDP HGVRLPMVLG VTGLAAALVA AVGRALAARP GEALRVWVLA GVAGFVGTGL       240
     ASLGGAPPRL VWSLVLLGAL LAARFVPAVA VDVPDQYLID LDRLAVTAWS AREQPSGRRG       300
     RTVVPLDAVD AVAARGTRIV TAASAAVLAA VLLSAPLLLA AATLPIDRVG ARVLVGCAGA       360
     GLLLAARSYR HAAARALLRI AGLACGTVLA TALLGAAGRA GWWLAGLAVL TAAALVVAAV       420
     AVGRGWRSAW WSRRAEVAEG LAGATAVGAL VVASGWFRQL WELASLWKLG A                471
//

If you have problems or comments...

PBIL Back to PBIL home page