(data stored in ACNUC1104 zone)

EMBL: CP000509.PE3

CP000509.PE3         Location/Qualifiers
FT   CDS             3332..4237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: sco:SCO3877 putative 6-phosphogluconate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79553"
FT                   /db_xref="GOA:A1SCL8"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCL8"
FT                   /protein_id="ABL79553.1"
FT                   /translation="MHIGLVGLGKMGGNMRTRLRDAGHTVVGFDRNPDLADVDSLEAMV
FT                   EQLPSPKVVWVMVPAGDPTRETIRRLGELLDEGDLVVDGGNSKWTDDQENADLLAQRGV
FT                   GFVDCGVSGGVWGAKFGYALMCGGSDEDVAKVQPAFDALKPDEGGFVHAGKKVGAGHFA
FT                   KMVHNGIEYAMMQSYAEGWELLEKVDLVDNVTEVFDSWRSGTVIRSWLLDLLVTALEED
FT                   GHLDQITGYADDSGEGRWTVQAAIDNAVPMHVIAASLFARFTSRQDDSPAMKAVAAMRN
FT                   QFGGHAVHTEPPVGGDANPG"
     MHIGLVGLGK MGGNMRTRLR DAGHTVVGFD RNPDLADVDS LEAMVEQLPS PKVVWVMVPA        60
     GDPTRETIRR LGELLDEGDL VVDGGNSKWT DDQENADLLA QRGVGFVDCG VSGGVWGAKF       120
     GYALMCGGSD EDVAKVQPAF DALKPDEGGF VHAGKKVGAG HFAKMVHNGI EYAMMQSYAE       180
     GWELLEKVDL VDNVTEVFDS WRSGTVIRSW LLDLLVTALE EDGHLDQITG YADDSGEGRW       240
     TVQAAIDNAV PMHVIAASLF ARFTSRQDDS PAMKAVAAMR NQFGGHAVHT EPPVGGDANP       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page