(data stored in SCRATCH zone)

EMBL: CP000509.PE300

CP000509.PE300       Location/Qualifiers
FT   CDS             325817..326134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79850"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG5"
FT                   /protein_id="ABL79850.1"
FT                   /translation="MSQAPEMGQGERTLTRAAGLVADAKADFDGLSKSLEQQILAQQGK
FT                   WVGAGGSAFFTLHQAWTDRQRIITNALNEFEASLTSTERDNMSTDETQSSSYHRVAGRL
FT                   G"
     MSQAPEMGQG ERTLTRAAGL VADAKADFDG LSKSLEQQIL AQQGKWVGAG GSAFFTLHQA        60
     WTDRQRIITN ALNEFEASLT STERDNMSTD ETQSSSYHRV AGRLG                       105
//

If you have problems or comments...

PBIL Back to PBIL home page