(data stored in SCRATCH zone)

EMBL: CP000509.PE301

CP000509.PE301       Location/Qualifiers
FT   CDS             326167..326463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0306"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909; KEGG:
FT                   cgb:cg0672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79851"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG6"
FT                   /protein_id="ABL79851.1"
FT                   /translation="MTLDGLRVNHAGLDTVADDLGQAVKRIDDRLNRLESELAPLRSDW
FT                   SGSAQQAYTAAKAKWDGAMQEMKGLLQETSSTVVQSNAEYRAADQRGAASFDI"
     MTLDGLRVNH AGLDTVADDL GQAVKRIDDR LNRLESELAP LRSDWSGSAQ QAYTAAKAKW        60
     DGAMQEMKGL LQETSSTVVQ SNAEYRAADQ RGAASFDI                                98
//

If you have problems or comments...

PBIL Back to PBIL home page