(data stored in ACNUC1104 zone)

EMBL: CP000509.PE302

CP000509.PE302       Location/Qualifiers
FT   CDS             326594..327949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0307"
FT                   /product="CD9/CD37/CD63 antigen"
FT                   /note="TIGRFAM: CD9/CD37/CD63 antigen; KEGG: sma:SAV2527
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79852"
FT                   /db_xref="GOA:A1SDG7"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG7"
FT                   /protein_id="ABL79852.1"
FT                   /translation="MTQATAGRSGLVRVTVASGARRVDLVLPGAVPVAELVPELARSVG
FT                   LLDPATVYAGYRLVTAEGRRLAGDAGLVIQGVEDGGLLTVAAGVDDEPPRVYDDVVEAM
FT                   TDVVEHDLRPWEPASGRRTALVAAGLLMALGAVALLIQRGSLLAGATAVVVAVTLTAAA
FT                   VVLSRAQREAEAGVAVAWMATGYAAVAGLLLVTEDDPFFGLPVAAAGGAVLLTGLAGLV
FT                   GLGAGRALAIPPVVVGAVFLATGLVMRAAEFDPAAVLTSTLVLVVLAGSVLPWLALAVT
FT                   GTSVDPMYTVADVTAEPRPIDPARVAADARVAHEILVAVSATVGLLLVVVAPLAVSLGV
FT                   AGTVLAVLCCLVVMLRTRQYRTGSEVLVGLVSGVVGLLAVAASMLWLHPDWRPTAAVVL
FT                   AATGAALLALTMLPAPPSVRRGRLGDLAETVALLGLLPLLVLATGLFDAIRS"
     MTQATAGRSG LVRVTVASGA RRVDLVLPGA VPVAELVPEL ARSVGLLDPA TVYAGYRLVT        60
     AEGRRLAGDA GLVIQGVEDG GLLTVAAGVD DEPPRVYDDV VEAMTDVVEH DLRPWEPASG       120
     RRTALVAAGL LMALGAVALL IQRGSLLAGA TAVVVAVTLT AAAVVLSRAQ REAEAGVAVA       180
     WMATGYAAVA GLLLVTEDDP FFGLPVAAAG GAVLLTGLAG LVGLGAGRAL AIPPVVVGAV       240
     FLATGLVMRA AEFDPAAVLT STLVLVVLAG SVLPWLALAV TGTSVDPMYT VADVTAEPRP       300
     IDPARVAADA RVAHEILVAV SATVGLLLVV VAPLAVSLGV AGTVLAVLCC LVVMLRTRQY       360
     RTGSEVLVGL VSGVVGLLAV AASMLWLHPD WRPTAAVVLA ATGAALLALT MLPAPPSVRR       420
     GRLGDLAETV ALLGLLPLLV LATGLFDAIR S                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page