(data stored in SCRATCH zone)

EMBL: CP000509.PE303

CP000509.PE303       Location/Qualifiers
FT   CDS             327960..329408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79853"
FT                   /db_xref="GOA:A1SDG8"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG8"
FT                   /protein_id="ABL79853.1"
FT                   /translation="MATKKDLVEAYSFSRRRLVTAFVSGAPGGREVEPSRPGRTIIGGL
FT                   ALAVLLAAGAAIAGVLSPRTPDDWASNGLIVSKETGQAYVVLPAADGSAPEPDAPVELR
FT                   PVINITSARLILGADVEPMLISQDTIDDQRVGDDIGILGAPASLPAPGLLVETGWTACT
FT                   ADDRGMRVRVAVDPDVLPAPDAAQVVEVGGSFYLVASAQVGGDAAAAYALRLPGGDTVD
FT                   NLLGALDLPARVFAPTVPRGWLDLFPAGAALGWESFGLAGVGGRPDGWDAAQVPGRARV
FT                   GDVLRDATGDAVVLTADGPAELDPFALAVYSNTPIPGGGTPRVLPVDRFPDLARTRLPG
FT                   PDRHWPTTTVEPTETDPCAVLTTAGEEPAVVQLAQRPGPGYDARDVVPGHADVTVDPGR
FT                   GAYVRSASPEGARAPQPVAIDAKGRANPLDGDETAGLLGYADFPAPVVPDTWVKLFGAG
FT                   VPLSQNLALCPPAAAGAQDGPSCA"
     MATKKDLVEA YSFSRRRLVT AFVSGAPGGR EVEPSRPGRT IIGGLALAVL LAAGAAIAGV        60
     LSPRTPDDWA SNGLIVSKET GQAYVVLPAA DGSAPEPDAP VELRPVINIT SARLILGADV       120
     EPMLISQDTI DDQRVGDDIG ILGAPASLPA PGLLVETGWT ACTADDRGMR VRVAVDPDVL       180
     PAPDAAQVVE VGGSFYLVAS AQVGGDAAAA YALRLPGGDT VDNLLGALDL PARVFAPTVP       240
     RGWLDLFPAG AALGWESFGL AGVGGRPDGW DAAQVPGRAR VGDVLRDATG DAVVLTADGP       300
     AELDPFALAV YSNTPIPGGG TPRVLPVDRF PDLARTRLPG PDRHWPTTTV EPTETDPCAV       360
     LTTAGEEPAV VQLAQRPGPG YDARDVVPGH ADVTVDPGRG AYVRSASPEG ARAPQPVAID       420
     AKGRANPLDG DETAGLLGYA DFPAPVVPDT WVKLFGAGVP LSQNLALCPP AAAGAQDGPS       480
     CA                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page