(data stored in SCRATCH zone)

EMBL: CP000509.PE306

CP000509.PE306       Location/Qualifiers
FT   CDS             332756..333457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0312"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rha:RHA1_ro11203 response
FT                   regulator, two-component system"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79856"
FT                   /db_xref="GOA:A1SDH1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH1"
FT                   /protein_id="ABL79856.1"
FT                   /translation="MSGRRALVVEDEPELARLVGSYLERDGFAVTIVHDGLEAVARSRE
FT                   VDPDVVVLDLGLPGLDGVEVCRRLRTFSDGYVVMLTARSDEVDTLIGLSVGADDYLTKP
FT                   FSPRELVARVQAMLRRPRPLGHMDADAGEALSFGDLTIELAGRDVWLEDRAVPLTRTEF
FT                   DLLATLAQRPGMAFSRRQLIDAVWGPAWVGDEHLVDVHVGHLRHKLGDSAAEGRYVRTV
FT                   RGIGYRMGRGA"
     MSGRRALVVE DEPELARLVG SYLERDGFAV TIVHDGLEAV ARSREVDPDV VVLDLGLPGL        60
     DGVEVCRRLR TFSDGYVVML TARSDEVDTL IGLSVGADDY LTKPFSPREL VARVQAMLRR       120
     PRPLGHMDAD AGEALSFGDL TIELAGRDVW LEDRAVPLTR TEFDLLATLA QRPGMAFSRR       180
     QLIDAVWGPA WVGDEHLVDV HVGHLRHKLG DSAAEGRYVR TVRGIGYRMG RGA              233
//

If you have problems or comments...

PBIL Back to PBIL home page