(data stored in ACNUC1104 zone)

EMBL: CP000509.PE308

CP000509.PE308       Location/Qualifiers
FT   CDS             334652..337108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0314"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rha:RHA1_ro11210 probable
FT                   copper-exporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79858"
FT                   /db_xref="GOA:A1SDH3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH3"
FT                   /protein_id="ABL79858.1"
FT                   /translation="MATSAQHEHEHEHQHEHQHGAPHGAGTTTAVLEVSGVHWASSKSV
FT                   AEAVLSRQPGVLSVEANPVAQTATVTYDPRRTDLVRLRDWVRECGYHCAGRSVPRHVCD
FT                   PMAEPVPTEGHEGHEGHDGHRPEHDAMTHDATTQGGHAHGGHAHGGHAGMSMADMARDM
FT                   RNRFLVALVLSVPIALYSPMGRDMLGFDAATPFGLRDDVLALVLSLPVVLYSAWIFFDG
FT                   AWRALRARTLDMMVLVAVAVGAGWLYSLGVTLTGGGEVFYEAATMLTTFVLLGHWFEMR
FT                   ARGGANDAIRTLLDLAPPVAEVLRDGEVVTVPTAEVVIGDLLLVRPGSRIATDGLVEEG
FT                   ESEVDESMVTGESMPVAKGPGDAVIGATVNTTGTLRVRATKVGADTALAHIVALVQEAQ
FT                   NSKAPGQKLADRAAYWLVLVALVAGVGTFLTWLAVGRPVDEALLFAITVVVITCPDALG
FT                   LATPTAIMVGSGLGAKRGILFKNATAIESAARLDTVVMDKTGTLTRGEPEVTEVVLAPG
FT                   VDEHRLLALVGAVERESEHPLARAVVEHADHAGVPRLRATGFANVAGHGAVAEVDGHRV
FT                   VVGNRRLMDREGVALDVLAEQRETIASGGRTAILVAIDGAASAVVGLADAVRPTSAAAV
FT                   AALHEAGVQVVMLTGDNEATARRIADQLGIDDVIAEVLPEDKAAQVVALQRQGRRVAHV
FT                   GDGVNDAPALAAADVGIAIGAGTDVAIETADVVLMRSDPLDVPTALTIGRGTRRKELQS
FT                   LGWAIGYNAIALPVAAGVFEPALGLTLRPEVAAMTMSGSSILVAVNALLLKRLRLPEVG
FT                   RRHEHV"
     MATSAQHEHE HEHQHEHQHG APHGAGTTTA VLEVSGVHWA SSKSVAEAVL SRQPGVLSVE        60
     ANPVAQTATV TYDPRRTDLV RLRDWVRECG YHCAGRSVPR HVCDPMAEPV PTEGHEGHEG       120
     HDGHRPEHDA MTHDATTQGG HAHGGHAHGG HAGMSMADMA RDMRNRFLVA LVLSVPIALY       180
     SPMGRDMLGF DAATPFGLRD DVLALVLSLP VVLYSAWIFF DGAWRALRAR TLDMMVLVAV       240
     AVGAGWLYSL GVTLTGGGEV FYEAATMLTT FVLLGHWFEM RARGGANDAI RTLLDLAPPV       300
     AEVLRDGEVV TVPTAEVVIG DLLLVRPGSR IATDGLVEEG ESEVDESMVT GESMPVAKGP       360
     GDAVIGATVN TTGTLRVRAT KVGADTALAH IVALVQEAQN SKAPGQKLAD RAAYWLVLVA       420
     LVAGVGTFLT WLAVGRPVDE ALLFAITVVV ITCPDALGLA TPTAIMVGSG LGAKRGILFK       480
     NATAIESAAR LDTVVMDKTG TLTRGEPEVT EVVLAPGVDE HRLLALVGAV ERESEHPLAR       540
     AVVEHADHAG VPRLRATGFA NVAGHGAVAE VDGHRVVVGN RRLMDREGVA LDVLAEQRET       600
     IASGGRTAIL VAIDGAASAV VGLADAVRPT SAAAVAALHE AGVQVVMLTG DNEATARRIA       660
     DQLGIDDVIA EVLPEDKAAQ VVALQRQGRR VAHVGDGVND APALAAADVG IAIGAGTDVA       720
     IETADVVLMR SDPLDVPTAL TIGRGTRRKE LQSLGWAIGY NAIALPVAAG VFEPALGLTL       780
     RPEVAAMTMS GSSILVAVNA LLLKRLRLPE VGRRHEHV                               818
//

If you have problems or comments...

PBIL Back to PBIL home page