(data stored in ACNUC1104 zone)

EMBL: CP000509.PE309

CP000509.PE309       Location/Qualifiers
FT   CDS             337121..337762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0315"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   nfa:nfa38100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79859"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH4"
FT                   /protein_id="ABL79859.1"
FT                   /translation="MIPHPARSRRGSPMGKTLTALVAALATMLVLSSCGGGENGDGEPA
FT                   AHTAADGQRFNDADVAFATDMVQHHAQALAMVDQTMGRDLGPRVERLAESIRAAQGPEI
FT                   ETMTGWLTDWDQPIPETVRDHANAHGGHVETDPDMPGMMSPEQMAELEAAPDAEFAQLF
FT                   LTMMIDHHEGAVEMARAEQRDGLHPDAVALAEQIESAQNREIATMQRMLS"
     MIPHPARSRR GSPMGKTLTA LVAALATMLV LSSCGGGENG DGEPAAHTAA DGQRFNDADV        60
     AFATDMVQHH AQALAMVDQT MGRDLGPRVE RLAESIRAAQ GPEIETMTGW LTDWDQPIPE       120
     TVRDHANAHG GHVETDPDMP GMMSPEQMAE LEAAPDAEFA QLFLTMMIDH HEGAVEMARA       180
     EQRDGLHPDA VALAEQIESA QNREIATMQR MLS                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page