(data stored in ACNUC1104 zone)

EMBL: CP000509.PE310

CP000509.PE310       Location/Qualifiers
FT   CDS             complement(337850..339403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0316"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   mpa:MAP2359c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79860"
FT                   /db_xref="GOA:A1SDH5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH5"
FT                   /protein_id="ABL79860.1"
FT                   /translation="MMMHPILQAATSSTELGFPWWLQVTHLVNFLFLGLLVRSGWEILA
FT                   SHPRLYWRNDCGPDTEWLKFTKDKVPSEIGAFTARDDQRDLHPLISLPGRAKIGIGRAW
FT                   HGLITTLWVLNGLIYVVLLFGTGQWRRLIPTSWSVFPEAWDSLKIYAGFGVPSIEHFQP
FT                   YDALQQLMYTFVVFVLAPLMIVTGPVMSPAVVGRYPWYPKLFGGRQAARSLHFLGMAFF
FT                   VVFAVMHVALVLLVHREHNLVHMMMGEEYDAALVGQAVTRVIVGVVVVVALWIAASYVS
FT                   LIDVRKSQRVLYGLQAPIKKLVLNPMTSRQRARQVFTEDDISPFHWVNTRPPDLSQSPE
FT                   WLALRDGGFRDFRLEVGGLVREPRSFSLDELREIAAQDQITMHTCMQGWTGIAKWSGIP
FT                   LREVLAQVEPLEGADYVMIESFGTAQHMHDGRPVEPYYTVLTKAMAMEDETILAWGMNG
FT                   APLPEMYGAPLRLRTESMHGYKMVKWVRSVSWIHDYKEVGDGMGGTREDSGYQDMDARI
FT                   "
     MMMHPILQAA TSSTELGFPW WLQVTHLVNF LFLGLLVRSG WEILASHPRL YWRNDCGPDT        60
     EWLKFTKDKV PSEIGAFTAR DDQRDLHPLI SLPGRAKIGI GRAWHGLITT LWVLNGLIYV       120
     VLLFGTGQWR RLIPTSWSVF PEAWDSLKIY AGFGVPSIEH FQPYDALQQL MYTFVVFVLA       180
     PLMIVTGPVM SPAVVGRYPW YPKLFGGRQA ARSLHFLGMA FFVVFAVMHV ALVLLVHREH       240
     NLVHMMMGEE YDAALVGQAV TRVIVGVVVV VALWIAASYV SLIDVRKSQR VLYGLQAPIK       300
     KLVLNPMTSR QRARQVFTED DISPFHWVNT RPPDLSQSPE WLALRDGGFR DFRLEVGGLV       360
     REPRSFSLDE LREIAAQDQI TMHTCMQGWT GIAKWSGIPL REVLAQVEPL EGADYVMIES       420
     FGTAQHMHDG RPVEPYYTVL TKAMAMEDET ILAWGMNGAP LPEMYGAPLR LRTESMHGYK       480
     MVKWVRSVSW IHDYKEVGDG MGGTREDSGY QDMDARI                                517
//

If you have problems or comments...

PBIL Back to PBIL home page