(data stored in ACNUC1104 zone)

EMBL: CP000509.PE313

CP000509.PE313       Location/Qualifiers
FT   CDS             342619..343218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0319"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: sco:SCO3618 putative recomination protein;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein;
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79863"
FT                   /db_xref="GOA:A1SDH8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDH8"
FT                   /protein_id="ABL79863.1"
FT                   /translation="MYEGVVQDLIDELGRLPGVGPKGAQRIAFHLLQADPADVRRLADV
FT                   LLEVKAKVKFCSICFNVSQDDQCRICRDPRRDPSVLCVVEEYKDVVAIERTREFRGRYH
FT                   VLGGAISPIDGVGPEQLRIRELMVRLADGTITEVILATDPNLEGEATATYLTRMLKPLE
FT                   LRVTRLASGLPVGGDLEYADEVTLGRAFAGRRSADD"
     MYEGVVQDLI DELGRLPGVG PKGAQRIAFH LLQADPADVR RLADVLLEVK AKVKFCSICF        60
     NVSQDDQCRI CRDPRRDPSV LCVVEEYKDV VAIERTREFR GRYHVLGGAI SPIDGVGPEQ       120
     LRIRELMVRL ADGTITEVIL ATDPNLEGEA TATYLTRMLK PLELRVTRLA SGLPVGGDLE       180
     YADEVTLGRA FAGRRSADD                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page